PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_8147g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 436aa    MW: 49534.1 Da    PI: 8.8354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_8147g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-1579126148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+ Ed +l ++++ +G g W+ I+++ g++R++k+c++rw++yl
     MA_8147g0020  79 RGAWTKKEDMILSEYIRIHGDGGWRNIPKKAGLKRCGKSCRLRWLNYL 126
                      89********************************************97 PP

2Myb_DNA-binding53.65.2e-17132177148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++E+el+v+++++lG++ W++Ia +++ gRt++++k++w++++
     MA_8147g0020 132 RGNISPDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHM 177
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-2370129IPR009057Homeodomain-like
PROSITE profilePS5129416.38874126IPR017930Myb domain
SuperFamilySSF466897.65E-2877173IPR009057Homeodomain-like
SMARTSM007178.2E-1378128IPR001005SANT/Myb domain
PfamPF002492.2E-1479126IPR001005SANT/Myb domain
CDDcd001671.16E-981126No hitNo description
PROSITE profilePS5129426.565127181IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-25130181IPR009057Homeodomain-like
SMARTSM007176.8E-16131179IPR001005SANT/Myb domain
PfamPF002497.3E-15132176IPR001005SANT/Myb domain
CDDcd001672.03E-11136177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MVITSQGFTV TTVLVRRKLC RFLYILNGPA KGNRRGQHCG SSQQIRGSAA VDLVFKGIRG  60
CRKYKMGRSP CCSKEGLNRG AWTKKEDMIL SEYIRIHGDG GWRNIPKKAG LKRCGKSCRL  120
RWLNYLRPDI KRGNISPDEE ELIVRLHRLL GNRWSLIAGR LPGRTDNEIK NYWNTHMSKK  180
LLSMNESQTK TLPDLKTRSK YPFPLQNQVF KANPVKITTV VRPSELVKPN GYTNRRSDEA  240
FRLSNVRNSC KSRYHLPVNN SITESESKPI TFAKADNLVE TEAAKSTISM SSLADQQSPQ  300
SNHFDAATLA ESLLYLNELS SPDSHLLSYP SNCSTDFGLE EFYGGSATFA GRTNEFEDMC  360
CDQSNMERLN NFTVADKQEM EELFHNAQRL DWIHEVDDLQ KSSPEQLSLL LLESEDEWEE  420
RATGKAVLEN SEQLIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-257718125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1167520.0BT116752.1 Picea glauca clone GQ03806_A01 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LMJ61e-165B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.15e-65myb domain protein 3